PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_017045-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family EIL
Protein Properties Length: 465aa    MW: 52032.7 Da    PI: 4.8358
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_017045-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3183.91.5e-56391542120
                      XXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
             EIN3   2 elkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWW 95 
                      el+krmwkd+++lkr+ker+k +  ++  a++++k +++++qarrkkmsraQDgiLkYMlk mevc+a+GfvYgiipekgkpv+g+sd++raWW
  AHYPO_017045-RA  39 ELEKRMWKDRIKLKRIKEREKLE--AQR-AAEKQKPKQTSDQARRKKMSRAQDGILKYMLKLMEVCKARGFVYGIIPEKGKPVSGSSDNIRAWW 129
                      89****************99964..455.599************************************************************** PP

                      XXXXXXXXXXXXXXXXXXXXXXXXX CS
             EIN3  96 kekvefdrngpaaiskyqaknlils 120
                      kekv+fd+ngpaai+ky+a++l+l 
  AHYPO_017045-RA 130 KEKVKFDKNGPAAIAKYDAECLALR 154
                      ********************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048731.6E-5539153No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042762Biological Processregulation of sulfur metabolic process
GO:0071281Biological Processcellular response to iron ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 465 aa     Download sequence    Send to blast
MAELEEIGPD YDSDIEVDEL RCGNIAEKDV SEEEIEPVEL EKRMWKDRIK LKRIKEREKL  60
EAQRAAEKQK PKQTSDQARR KKMSRAQDGI LKYMLKLMEV CKARGFVYGI IPEKGKPVSG  120
SSDNIRAWWK EKVKFDKNGP AAIAKYDAEC LALRSPPCPR GEKRKPAASS DSDYDVDGID  180
DGARSVSSKD GRKNQQSDAE TIGEPLNNAR SSVRSKIPVE KQTKRKRPRG KANSSDPKTK  240
PSKDDQPMAM PLSEPQAAPS TNNNLGDELV GPVPDADHNN ADLNGFPMHD SQQDNGLFIE  300
PLMPTDNDLL GQYHPPTSDY SQFSHLSNAR PPNMMSEQNM FVGGEYFHHP TVQNTDLQHG  360
DSYYNASVQY GQRVDEQRLQ HTVSEPQSRQ EAVGMHLPAL NTIGNEINGG SLQNFAVDRS  420
FDESPFTGHT ITDDIFDFPW INEGFTLDDC PTLDEDDFLL YCGA*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00233DAPTransfer from AT1G73730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010688276.11e-98PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein
RefseqXP_010688277.11e-98PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein
TrEMBLA0A0B0PYY21e-117A0A0B0PYY2_G
STRINGPOPTR_0003s22090.12e-83(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.14e-52ETHYLENE-INSENSITIVE3-like 3